PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G019200.1.p
Common NameLOC101777662, SETIT_026864mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 206aa    MW: 22110.2 Da    PI: 7.3627
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G019200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47.1e-45161151100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+
  Seita.8G019200.1.p  16 PCASCKLLRRRCTQECVFAPYFPPEDPQKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQLQ 106
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +lal+k+e
  Seita.8G019200.1.p 107 MQLALAKAE 115
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.18208.5E-55167IPR029058Alpha/Beta hydrolase fold
PROSITE profilePS5089126.74815116IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4416113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MAGSGSSSGS GSSSSPCASC KLLRRRCTQE CVFAPYFPPE DPQKFAIVHK VFGASNVSKM  60
LQELPAQQRA DAVSSLVYEA NARMRDPVYG CVGAISYLQQ QVSQLQMQLA LAKAEILCVQ  120
MQHDGHATVS SPPLSASQQL ERKQQQLMEC EAYGSLLMQD GLINASFNST AAAHHQQQMM  180
GSLGSAGNTA MMLQEACLKK ESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978582.11e-150PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK3ZJV91e-150K3ZJV9_SETIT; Uncharacterized protein
STRINGSi026864m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-58LBD family protein